PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf01822g01036.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family ZF-HD
Protein Properties Length: 206aa    MW: 23401.9 Da    PI: 6.6388
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf01822g01036.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer105.43.6e-3353107358
               ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                               k +YkeClkNhA+ +GghavDGCgEfmp+ ge+g+ ++lkCaAC+CHRnFHR+ ++
  Peinf101Scf01822g01036.1  53 KPKYKECLKNHAVGIGGHAVDGCGEFMPA-GEDGSLDSLKCAACNCHRNFHRKVPT 107
                               679*************************9.999********************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015664.7E-3155104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047709.4E-3055105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-2155104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.82256105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.605.0E-16167205IPR009057Homeodomain-like
SuperFamilySSF466898.96E-7168205IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MDQFEDQEDQ KQVEEIQPSH DSLNNTNSTQ PKMPSPPHPQ QQQLVQYNTW NNKPKYKECL  60
KNHAVGIGGH AVDGCGEFMP AGEDGSLDSL KCAACNCHRN FHRKVPTTPP AEHFVYHPSY  120
YRTLPPPCGY LHHVAPQQRP LALPSTSGGG GYREDLEDMS NPNSSGDKLG WRIQRDDEEL  180
VQQFCNETGV RRQVFKVWMH NNKHTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A2e-141662053675ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009769508.11e-97PREDICTED: zinc-finger homeodomain protein 2-like isoform X1
RefseqXP_009769511.19e-98PREDICTED: zinc-finger homeodomain protein 2-like isoform X2
RefseqXP_016472938.19e-98PREDICTED: zinc-finger homeodomain protein 2-like
SwissprotQ6YXH52e-51ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLM1C6691e-92M1C669_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000606234e-92(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.14e-52homeobox protein 22